Property Summary

NCBI Gene PubMed Count 20
PubMed Score 228.68

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Lymphoma 57 4.251 2.1
Amebiasis 22 3.54 1.8
Leukemia 88 3.281 1.6


Accession P0CG06 A0M8Q4 P80423
Symbols IGLC



1AQK   7FAB  

Gene RIF (1)

12077254 The IGL C lambda 3 amplification polymorphism has been analyzed and its sequence structure determined.

AA Sequence

YLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106

Text Mined References (20)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077254 2002 Unraveling of the polymorphic C lambda 2-C lambda 3 amplification and the Ke+Oz- polymorphism in the human Ig lambda locus.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8676895 Recombinant human Fab antibody fragments to HIV-1 Rev and Tat regulatory proteins: direct selection from a combinatorial phage display library.
7737190 1995 Characterization of the two unique human anti-flavin monoclonal immunoglobulins.
6404900 1983 Comparative studies on the structure of the light chains of human immunoglobulins. IV. Assignment of a subsubgroup.
6273747 1981 Clustered arrangement of immunoglobulin lambda constant region genes in man.
5549568 1971 [Structural rule of antibodies. Primary structure of a monoclonal immunoglobulin-L-chain of the lambda type, subgroup IV (Bence-Jones-protein Kern). V. The complete amino acid sequence and its genetic interpretation].