Property Summary

NCBI Gene PubMed Count 23
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106
//

Text Mined References (28)

PMID Year Title