Property Summary

NCBI Gene PubMed Count 23
PubMed Score 228.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P0CG05 A0M8Q4 P80423
Symbols IGLC

Gene

PDB

1JVK   1LIL   1ZVO   2JB5   2JB6   3C2A   3TV3   3TWC   3TYG   4EOW   4LLD   4LLM   4LLQ   4LLU   4LLW   4LLY   4O58   4O5I   5IQ7   5IQ9  

Gene RIF (2)

PMID Text
20637260 Results have shown that RNA interference can markedly reduce LC synthesis and provide the basis for testing the therapeutic potential of this strategy using in vivo experimental models of multiple myeloma.
12077254 The IGL C lambda 2 amplification polymorphism has been analyzed and its sequence structure determined.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106
//

Text Mined References (23)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
20637260 2010 Inhibition of pathologic immunoglobulin-free light chain production by small interfering RNA molecules.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077254 2002 Unraveling of the polymorphic C lambda 2-C lambda 3 amplification and the Ke+Oz- polymorphism in the human Ig lambda locus.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
7737190 1995 Characterization of the two unique human anti-flavin monoclonal immunoglobulins.
More...