Property Summary

NCBI Gene PubMed Count 26
PubMed Score 228.68

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Lymphoma 57 4.251 2.1
Amebiasis 22 3.54 1.8
Leukemia 88 3.281 1.6


Accession P0CG04 A0M8Q4 P01842 P80423
Symbols IGLC



1ZVO   2FB4   2IG2  

Gene RIF (2)

23303672 The human Iglambda locus is isolated intact as an ~300-kilobase yeast artificial chromosome (YAC) and also fully inserted into a rat chromosome.
12077254 New sequencing data show that the Mcg-Ke+Oz- isotype is encoded by a polymorphic C lambda 2 gene segment that differs from the normal J-C lambda 2 region at a single nucleotide position.

AA Sequence

YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106

Text Mined References (27)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23303672 2013 High-affinity IgG antibodies develop naturally in Ig-knockout rats carrying germline human IgH/Ig?/Ig? loci bearing the rat CH region.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15174051 2004 An investigation into the human serum "interactome".
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.