Property Summary

NCBI Gene PubMed Count 26
PubMed Score 230.69

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (2)

AA Sequence

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS                                       71 - 106
//

Text Mined References (32)

PMID Year Title