Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CG01
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20138039 Gastrokine 3 (Gkn3) encodes a novel, functionally distinct gastrokine overexpressed. Spread of the GKN3 stop allele W59X might have been selected for among non-Africans because of its effects on pre-neoplastic outcomes in the stomach.

AA Sequence

MKHLVASSILGVFVLTPSLAMMNIRFNHPLYGSFGTQIIHIGAFQGMVSIRDNNIFSEWDGILDYKNALL      1 - 70
VAKVFNKMACVLARMDKAVFPSLDDISKALDKQAFKYYPSTRGLTYTVLPSWVKNLAQYGKPIKNMCRDD     71 - 140
PTYFAQQQKEGTALAIDSNSCFEIQLLSFMGLFICGETPGL                                 141 - 181
//

Text Mined References (4)

PMID Year Title
23715263 2013 Evolution of the human gastrokine locus and confounding factors regarding the pseudogenicity of GKN3.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20138039 2010 A novel gastrokine, Gkn3, marks gastric atrophy and shows evidence of adaptive gene loss in humans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.