Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CG01
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MKHLVASSILGVFVLTPSLAMMNIRFNHPLYGSFGTQIIHIGAFQGMVSIRDNNIFSEWDGILDYKNALL      1 - 70
VAKVFNKMACVLARMDKAVFPSLDDISKALDKQAFKYYPSTRGLTYTVLPSWVKNLAQYGKPIKNMCRDD     71 - 140
PTYFAQQQKEGTALAIDSNSCFEIQLLSFMGLFICGETPGL                                 141 - 181
//

Text Mined References (4)

PMID Year Title