Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 8.66260377469311E-8
atypical teratoid / rhabdoid tumor 4369 1.40704454965597E-7
medulloblastoma 1524 1.30389080763513E-6
cystic fibrosis 1670 3.97470260678877E-6
pediatric high grade glioma 2712 7.01923251111221E-6
glioblastoma 5572 4.31435802843138E-5
medulloblastoma, large-cell 6234 7.91304684418271E-4
ovarian cancer 8492 0.00178433164538405
osteosarcoma 7933 0.00411670047398056
oligodendroglioma 2849 0.00527413395264079
astrocytic glioma 2241 0.00995515297547554
subependymal giant cell astrocytoma 2287 0.017034743356823
active ulcerative colitis 477 0.0263104519758169
ependymoma 2514 0.02866998196864

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.100 0.010
ependymoma -1.200 0.029
oligodendroglioma -1.600 0.005
osteosarcoma -1.357 0.004
glioblastoma -2.000 0.000
cystic fibrosis -1.524 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.700 0.001
tuberculosis 1.400 0.000
active ulcerative colitis -1.110 0.026
pediatric high grade glioma -1.600 0.000
subependymal giant cell astrocytoma -1.552 0.017
ovarian cancer -1.400 0.002

Synonym

Accession P0CF97
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
18187620 Knockdown of family with sequence similarity 200, member B (FAM200B; LOC285550) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MDHFFIKRKRNSEVKYTEACSSSSVESGIVNSDNIEKNTDSNLQTSTSFEPHFKKKKVSARRYNEDYLKY      1 - 70
GFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCST     71 - 140
AVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFDDKSADKLKTIPNDNTVSLRICTIAEH    141 - 210
LETMLITRLQSGIDFAIQLDESTDIGSCTTLLVYVRYAWQDDFLEDFLCFLNLTSHLSGLDIFTELERRI    211 - 280
VGQYKLNWKNCKGITSDGTATMTGKHSRVIKKLLEVTNNGAVWNHCFIHREGLASREIPQNLMEVLKNAV    281 - 350
KVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIF    351 - 420
EDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPSYYMFPRFLQH    421 - 490
IEENIINENILKEIKLEILLHLTSLSQTFNHFFPEEKFETLRENSWVKDPFAFRHPESIIELNLVPEEEN    491 - 560
ELLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVLLLLPFTTTSLCELGFSILTQLKTKERNGLN    561 - 630
CAAVMRVALSSCVPDWNELMNRQAHPS                                               631 - 657
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.