Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.100 0.010
ependymoma -1.200 0.029
oligodendroglioma -1.600 0.005
osteosarcoma -1.357 0.004
glioblastoma -2.000 0.000
cystic fibrosis -1.524 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.700 0.001
tuberculosis 1.400 0.000
active ulcerative colitis -1.110 0.026
pediatric high grade glioma -1.600 0.000
subependymal giant cell astrocytoma -1.552 0.017
ovarian cancer -1.400 0.002

Gene RIF (1)

PMID Text
18187620 Knockdown of family with sequence similarity 200, member B (FAM200B; LOC285550) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MDHFFIKRKRNSEVKYTEACSSSSVESGIVNSDNIEKNTDSNLQTSTSFEPHFKKKKVSARRYNEDYLKY      1 - 70
GFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCST     71 - 140
AVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFDDKSADKLKTIPNDNTVSLRICTIAEH    141 - 210
LETMLITRLQSGIDFAIQLDESTDIGSCTTLLVYVRYAWQDDFLEDFLCFLNLTSHLSGLDIFTELERRI    211 - 280
VGQYKLNWKNCKGITSDGTATMTGKHSRVIKKLLEVTNNGAVWNHCFIHREGLASREIPQNLMEVLKNAV    281 - 350
KVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIF    351 - 420
EDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPSYYMFPRFLQH    421 - 490
IEENIINENILKEIKLEILLHLTSLSQTFNHFFPEEKFETLRENSWVKDPFAFRHPESIIELNLVPEEEN    491 - 560
ELLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVLLLLPFTTTSLCELGFSILTQLKTKERNGLN    561 - 630
CAAVMRVALSSCVPDWNELMNRQAHPS                                               631 - 657
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.