Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.19

Knowledge Summary

Patent

No data available

Synonym

Accession P0CF75 S4R316
Symbols EBLN-1

Gene

 Compartment GO Term (0)

AA Sequence

MSRPRNNPQTSSPQDSTKDGSSFHYFQGRFELSGKSRQYPADALEPQPGIGDVKVIEKATKSMLDPAQRS      1 - 70
HFYLVTPSLVFLCFIFDGLHKALLSVGVSKRSNIVIGNENKETGTLYASKFEDVLPTFTALEMSSILRHC     71 - 140
CDLIGIAAGSSDPICTNSLQVQRQFKAMMISIGRPLHSESADLLISYNAGPAIDWINSRPWVGGLMFTFL    141 - 210
FGEFESPACELLDQVKVVASKAQMMTYYTVRMFLDQCVDGSTALPAVVLEIPVFEQKKPLAKKVLGDFFE    211 - 280
FGGVLRHPVIGVLSPQMFPNLATAANYWAKRRNSTFSGFEALDIIPGSTITFPVLQMASAQKISRGSDMD    281 - 350
PYTLNILRGYGISGFE                                                          351 - 366
//

Text Mined References (5)

PMID Year Title
23938751 2013 Comprehensive analysis of endogenous bornavirus-like elements in eukaryote genomes.
21912690 2011 No evidence for natural selection on endogenous borna-like nucleoprotein elements after the divergence of Old World and New World monkeys.
20686665 2010 Unexpected inheritance: multiple integrations of ancient bornavirus and ebolavirus/marburgvirus sequences in vertebrate genomes.
20054395 2010 Endogenous non-retroviral RNA virus elements in mammalian genomes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.