Property Summary

NCBI Gene PubMed Count 6
PubMed Score 228.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P0CF74
Symbols IGLC

Gene

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSKQSNNKYAASS      1 - 70
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS                                       71 - 106
//

Text Mined References (6)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
10591208 1999 The DNA sequence of human chromosome 22.
6273747 1981 Clustered arrangement of immunoglobulin lambda constant region genes in man.
3122211 1987 Human immunoglobulin C lambda 6 gene encodes the Kern+Oz-lambda chain and C lambda 4 and C lambda 5 are pseudogenes.
814163 1976 Physicochemical and functional characterization of the C1r subunit of the first complement component.