Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary


No data available

AA Sequence

MYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS                                         141 - 173

Text Mined References (2)

PMID Year Title