Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

AA Sequence

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEGNTMKTNDTYM      1 - 70
KFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLLLQLTNTSAYY     71 - 140
MYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS                                         141 - 173
//

Text Mined References (2)

PMID Year Title
2879283 1986 Genetic polymorphism and exon changes of the constant regions of the human T-cell rearranging gene gamma.
2527426 1989 The human T-cell receptor gamma (TRG) genes.