Property Summary

NCBI Gene PubMed Count 10
Grant Count 27
R01 Count 12
Funding $6,111,734.5
PubMed Score 162.43
PubTator Score 3.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (3)

PMID Text
26843644 Deletion of oncomodulin in outer hair cells, leads to a progressive hearing loss in transgenic mice.
21734401 Data indicate taht candidate genes ACTB, BZW, OCM, MACC1, NXPH1, PRPS1L1, RAC1 and RPA3, which lie within the DFNB90 region, were sequenced and no potentially causal variants were identified.
21084621 Ocm plays a central role in inflammation-induced regeneration in the optic nerve.

AA Sequence

MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQK      1 - 70
FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS                                    71 - 109
//

Text Mined References (12)

PMID Year Title
26843644 2016 Oncomodulin, an EF-Hand Ca2+ Buffer, Is Critical for Maintaining Cochlear Function in Mice.
21734401 2011 Novel autosomal recessive nonsyndromic hearing impairment locus DFNB90 maps to 7p22.1-p15.3.
21084621 2010 Long-distance axon regeneration in the mature optic nerve: contributions of oncomodulin, cAMP, and pten gene deletion.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15610002 2004 Solution structure of human beta-parvalbumin and structural comparison with its paralog alpha-parvalbumin and with their rat orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8611623 1996 The Ca2+(-)binding proteins parvalbumin and oncomodulin and their genes: new structural and functional findings.
More...