Property Summary

NCBI Gene PubMed Count 10
PubMed Score 170.38
PubTator Score 3.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (3)

AA Sequence

MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQK      1 - 70
FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS                                    71 - 109
//

Text Mined References (12)

PMID Year Title