Property Summary

NCBI Gene PubMed Count 19
PubMed Score 89.66
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
23832597 This study deministrated that Parvalbumin-immunoreactive neurons in the human claustrum.

AA Sequence

MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQK      1 - 70
FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS                                    71 - 109
//

Text Mined References (19)

PMID Year Title
23832597 2014 Parvalbumin-immunoreactive neurons in the human claustrum.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15610002 2004 Solution structure of human beta-parvalbumin and structural comparison with its paralog alpha-parvalbumin and with their rat orthologs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12583602 2002 Calcium-binding proteins: distribution and implication in mammalian placenta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9847074 1998 Toward a complete human genome sequence.
More...