Property Summary

NCBI Gene PubMed Count 19
PubMed Score 96.56
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.2e-08
Disease Target Count Z-score Confidence
Heart disease 306 0.0 1.4

Gene RIF (1)

AA Sequence

MSITDVLSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQK      1 - 70
FESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS                                    71 - 109
//

Text Mined References (19)

PMID Year Title