Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MPAKDIKVALPRSQGHWSNADILRLLECMENNLPYDDNGTFSSTQSHMDWGKVAFKNFSGEMCRLKWLEI      1 - 70
SCSLRKFSTLKKLVLEAKKCVKNTNKSQKGRNHPDFPKRLLTAYIRFFKENWPQYSQMYPGMRSQEVTKI     71 - 140
LSKKYKELPEQMKQKHIQDFRKEKQEFEEKLARFREEHPDLDQKGKKSDICKRVQTKVQKKVQKNIEEVR    141 - 210
SLPKTDQFFKKVKFHGEPQKPPMNGYQKFHQDSWSSKELQHLSLRERMVEIGRRWQRIPQSQKDHYKSQA    211 - 280
ELLQKEYKVELDLWLKTLSPEDYAAYKESTYAKGKNMAMMGGPAPSLKQTDPQSSSAKGLQEGFGEGQGL    281 - 350
QAAGTEASQTIWVNCQVSMEPEDNRKKDGEEEESSNSLDCSSGEDMEVDV                        351 - 400
//

Text Mined References (1)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.