Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 8.5e-10
psoriasis 6694 5.3e-04

Expression

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MPAKDIKVALPRSQGHWSNADILRLLECMENNLPYDDNGTFSSTQSHMDWGKVAFKNFSGEMCRLKWLEI      1 - 70
SCSLRKFSTLKKLVLEAKKCVKNTNKSQKGRNHPDFPKRLLTAYIRFFKENWPQYSQMYPGMRSQEVTKI     71 - 140
LSKKYKELPEQMKQKHIQDFRKEKQEFEEKLARFREEHPDLDQKGKKSDICKRVQTKVQKKVQKNIEEVR    141 - 210
SLPKTDQFFKKVKFHGEPQKPPMNGYQKFHQDSWSSKELQHLSLRERMVEIGRRWQRIPQSQKDHYKSQA    211 - 280
ELLQKEYKVELDLWLKTLSPEDYAAYKESTYAKGKNMAMMGGPAPSLKQTDPQSSSAKGLQEGFGEGQGL    281 - 350
QAAGTEASQTIWVNCQVSMEPEDNRKKDGEEEESSNSLDCSSGEDMEVDV                        351 - 400
//

Text Mined References (1)

PMID Year Title