Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 4.2e-03

Gene RIF (1)

AA Sequence

MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKWLEISCNLRKF      1 - 70
GTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPGMRSQELTKILSKKYRE     71 - 140
LPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKKSSVSKRTQNKVQKKFQKNIEEVRSLPKTDR    141 - 210
FFKKVKFHGEPQKPPMNGYHKFHQDSWSSKEMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQY    211 - 280
KVKLDLWLKTLSPENYAAYKESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDS    281 - 350
SQTIWVNCHVSMEPEENRKKDREKEESSNSSDCSSGEEIEVDV                               351 - 393
//

Text Mined References (2)

PMID Year Title