Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Gene RIF (1)

PMID Text
19915186 Functionally characterizes an homologous mouse gene and product, and compares it to this human product.

AA Sequence

MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKWLEISCNLRKF      1 - 70
GTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPGMRSQELTKILSKKYRE     71 - 140
LPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKKSSVSKRTQNKVQKKFQKNIEEVRSLPKTDR    141 - 210
FFKKVKFHGEPQKPPMNGYHKFHQDSWSSKEMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQY    211 - 280
KVKLDLWLKTLSPENYAAYKESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDS    281 - 350
SQTIWVNCHVSMEPEENRKKDREKEESSNSSDCSSGEEIEVDV                               351 - 393
//

Text Mined References (2)

PMID Year Title
19915186 2010 Involvement of a novel preimplantation-specific gene encoding the high mobility group box protein Hmgpi in early embryonic development.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.