Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 3.000 1.2e-11
cystic fibrosis 1.657 5.4e-05
ependymoma 2.400 3.2e-10
glioblastoma 1.400 2.8e-05
group 3 medulloblastoma 1.700 2.5e-04
intraductal papillary-mucinous carcinoma... -1.100 1.6e-02
medulloblastoma, large-cell 1.800 1.0e-05
pediatric high grade glioma 1.800 1.6e-05
pituitary cancer 1.300 2.0e-02
primitive neuroectodermal tumor 1.500 8.2e-03

AA Sequence

MNVAAKYRMASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQLADAQKALDT      1 - 70
MNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGSKGYA     71 - 140
FVHFQNQSAADRAIEEMNGKLLKGCKVFVGRFKNRKDREAELRSKASEFTNVYIKNFGGDMDDERLKDVF    141 - 210
SKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQLIFVGRAQKKVERQAELKQMFE    211 - 280
QLKRERIRGCQGVKLYIKNLDDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMT    281 - 350
EMNGRILGSKPLSIALAQRH                                                      351 - 370
//

Text Mined References (4)

PMID Year Title