Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.35862198015677E-16
atypical teratoid / rhabdoid tumor 4369 1.23596714695308E-11
sonic hedgehog group medulloblastoma 1482 7.75889304438575E-7
medulloblastoma, large-cell 6234 1.04825772476058E-5
pediatric high grade glioma 2712 1.60686213557628E-5
cystic fibrosis 1670 5.39215646249435E-5
glioblastoma 5572 2.18074655492313E-4
primitive neuroectodermal tumor 3031 0.00819937556470678
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0160418638911041
pituitary cancer 1972 0.0198622287815988
Disease Target Count Z-score Confidence
Major Depressive Disorder 106 3.081 1.5

Expression

AA Sequence

MNVAAKYRMASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQLADAQKALDT      1 - 70
MNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGSKGYA     71 - 140
FVHFQNQSAADRAIEEMNGKLLKGCKVFVGRFKNRKDREAELRSKASEFTNVYIKNFGGDMDDERLKDVF    141 - 210
SKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQLIFVGRAQKKVERQAELKQMFE    211 - 280
QLKRERIRGCQGVKLYIKNLDDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMT    281 - 350
EMNGRILGSKPLSIALAQRH                                                      351 - 370
//

Text Mined References (4)

PMID Year Title
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11181995 2001 The sequence of the human genome.