Property Summary

NCBI Gene PubMed Count 25
Grant Count 2
R01 Count 2
Funding $294,507.33
PubMed Score 15.01
PubTator Score 21.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Gene RIF (22)

PMID Text
24634214 Data indicate that phosphorylation of Gdown1 on Ser-270 reduces Its affinity for RNA polymerase II.
24596085 Modification of TFIIF provides one pathway through which efficient Gdown1 loading can occur early in elongation, allowing downstream pausing to be regulated.
23274668 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
23274668 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
23087374 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
23087374 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
23028129 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
22567366 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
22422068 A small molecule compound C3 inhibits HIV-1 replication by suppressing HIV-1 Tat-mediated HIV-1 LTR-driven gene expression and phosphorylation of RNAPII through inhibition of Tat binding to CycT1
22244332 Gdown1 competes with TFIIF for binding to the RPB1 and RPB5 subunits of Pol II, thereby inhibiting an essential function of TFIIF in preinitiation complex assembly.
More...

AA Sequence

MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR      1 - 70
KSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD     71 - 140
EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE    141 - 210
ENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRR    211 - 280
DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESS    281 - 350
GRYREVRDEDDDWSSDEF                                                        351 - 368
//

Text Mined References (26)

PMID Year Title
24634214 2014 Regulation of RNA polymerase II termination by phosphorylation of Gdown1.
24596085 2014 Functional interactions of the RNA polymerase II-interacting proteins Gdown1 and TFIIF.
22850672 2012 Regulation of mammalian transcription by Gdown1 through a novel steric crosstalk revealed by cryo-EM.
22244332 2012 Transcriptional regulation by Pol II(G) involving mediator and competitive interactions of Gdown1 and TFIIF with Pol II.
22244331 2012 Functional association of Gdown1 with RNA polymerase II poised on human genes.
22231121 Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.
20412299 2010 Structural basis for the interaction between dynein light chain 1 and the glutamate channel homolog GRINL1A.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17361039 2007 Alterations in expression of glutamatergic transporters and receptors in sporadic Alzheimer's disease.
More...