Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.11
PubTator Score 21.32

Knowledge Summary

Patent

No data available

 GO Process (1)

Gene RIF (21)

AA Sequence

MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR      1 - 70
KSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD     71 - 140
EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE    141 - 210
ENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRR    211 - 280
DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESS    281 - 350
GRYREVRDEDDDWSSDEF                                                        351 - 368
//

Text Mined References (27)

PMID Year Title