Property Summary

NCBI Gene PubMed Count 26
PubMed Score 70.58
PubTator Score 21.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.235 2.4e-02
Astrocytoma, Pilocytic 1.300 6.1e-03
Breast cancer -1.500 3.6e-09
breast carcinoma -1.500 4.7e-17
ductal carcinoma in situ -3.100 2.4e-04
interstitial cystitis -1.800 5.9e-04
invasive ductal carcinoma -3.900 2.3e-04
non-small cell lung cancer -2.737 3.1e-32
osteosarcoma -2.330 3.2e-04
ovarian cancer -1.900 9.2e-14
spina bifida -1.662 4.2e-02
ulcerative colitis -1.300 3.9e-07

Gene RIF (21)

AA Sequence

MLRSTSTVTLLSGGAARTPGAPSRRANVCRLRLTVPPESPVPEQCEKKIERKEQLLDLSNGEPTRKLPQG      1 - 70
VVYGVVRRSDQNQQKEMVVYGWSTSQLKEEMNYIKDVRATLEKVRKRMYGDYDEMRQKIRQLTQELSVSH     71 - 140
AQQEYLENHIQTQSSALDRFNAMNSALASDSIGLQKTLVDVTLENSNIKDQIRNLQQTYEASMDKLREKQ    141 - 210
RQLEVAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEKEALLEETNSFLKAIEE    211 - 280
ANKKMQAAEISLEEKDQRIGELDRLIERMEKERHQLQLQLLEHETEMSGELTDSDKERYQQLEEASASLR    281 - 350
ERIRHLDDMVHCQQKKVKQMVEEIESLKKKLQQKQLLILQLLEKISFLEGENNELQSRLDYLTETQAKTE    351 - 420
VETREIGVGCDLLPSQTGRTREIVMPSRNYTPYTRVLELTMKKTLT                            421 - 466
//

Text Mined References (29)

PMID Year Title