Knowledge Summary

Patent

No data available

Synonym

Accession P0C879
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MYNPWQVGASLAPARAGPRPFPTPRARPPDCSGGHAPSGFPALGLRTAQRPRPFSSSPRSASGRLRGPRP      1 - 70
VARGPAHSSSPTGLPAYLPPAAALDSQTSAPTVSPVTRPRVVARGKTPRVSLAGLETLSSLLHQQQLFD      71 - 139
//

Text Mined References (2)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.