Knowledge Summary

Patent

No data available

Synonym

Accession P0C879
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MYNPWQVGASLAPARAGPRPFPTPRARPPDCSGGHAPSGFPALGLRTAQRPRPFSSSPRSASGRLRGPRP      1 - 70
VARGPAHSSSPTGLPAYLPPAAALDSQTSAPTVSPVTRPRVVARGKTPRVSLAGLETLSSLLHQQQLFD      71 - 139
//

Text Mined References (2)

PMID Year Title