Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKWSLP      1 - 70
YFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELP     71 - 140
QLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYEL    141 - 210
YTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQ    211 - 280
QSQGCIAVNFWYDMEYDLKYSYFQLLDSLTKASGLD                                      281 - 316
//

Text Mined References (15)

PMID Year Title