Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
inflammatory breast cancer 286 1.7e-02

Expression

Synonym

Accession P0C866
Symbols FAM91A2

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MLLSWGGGESRRPVQEASSATDTDTNSQEDPADTASVRSLSLSAGHTKHIAFLFDSTLTAFLMMGNLSPV      1 - 70
QSTGEREAQRYFEHALTLRNTTLFLRHNKDLVVQTAQPDQPNYGFPLDLLRCESLLGLDPATGSRVLNKN     71 - 140
YTLLVSMAPLTNEIRPVSSCTPQHIGPAIPEVSSVWFKQYIYVYHITGQGPPSLLLSKGTRPRKLPDIFQ    141 - 210
SYDRLLITSWGHDPGVVPTSNVLTMLNDALTHSAVLIQEHGLHGIGETVHVPFPFDETELQEDSCQYGCS    211 - 280
//

Text Mined References (4)

PMID Year Title