Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
inflammatory breast cancer 404

Expression

Synonym

Accession P0C866
Symbols FAM91A2

Gene

 Compartment GO Term (0)

AA Sequence

MLLSWGGGESRRPVQEASSATDTDTNSQEDPADTASVRSLSLSAGHTKHIAFLFDSTLTAFLMMGNLSPV      1 - 70
QSTGEREAQRYFEHALTLRNTTLFLRHNKDLVVQTAQPDQPNYGFPLDLLRCESLLGLDPATGSRVLNKN     71 - 140
YTLLVSMAPLTNEIRPVSSCTPQHIGPAIPEVSSVWFKQYIYVYHITGQGPPSLLLSKGTRPRKLPDIFQ    141 - 210
SYDRLLITSWGHDPGVVPTSNVLTMLNDALTHSAVLIQEHGLHGIGETVHVPFPFDETELQEDSCQYGCS    211 - 280
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.