Property Summary

NCBI Gene PubMed Count 13
PubMed Score 25.21
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Gene RIF (8)

AA Sequence

MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTS      1 - 70
GEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRG     71 - 140
NIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTV    141 - 210
LSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAY    211 - 280
MSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP                     281 - 333
//

Text Mined References (15)

PMID Year Title