Property Summary

NCBI Gene PubMed Count 10
Grant Count 14
R01 Count 11
Funding $927,769.46
PubMed Score 18.61
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (5)

PMID Text
26523509 Study demonstrates that CTRP9 attenuates cytokine-induced vascular inflammation in endothelial cells mediated by AMPK activation.
26457306 Circulating and coronary CTRP9 plays an important role in the inflammation and coronary atherosclerosis of CAD patients. Serum CTRP9 is an independent protective factor of CAD
26419929 Results demonstrate that CTRP9 alleviates hepatic steatosis through relief of endoplasmic reticulum stress via the AMPK-mediated induction of autophagy.
25105737 Serum CTRP9 concentration was significantly and positively associated with arterial stiffness in patients with type 2 diabetes
24357853 Serum CTRP9 concentrations were positively associated with favorable glucose or metabolic phenotypes and absence of metabolic syndrome, independent of serum total adiponectin concentrations.

AA Sequence

MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTS      1 - 70
GEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRG     71 - 140
NIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTV    141 - 210
LSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAY    211 - 280
MSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP                     281 - 333
//

Text Mined References (12)

PMID Year Title
26523509 2016 C1q/TNF-related protein-9 inhibits cytokine-induced vascular inflammation and leukocyte adhesiveness via AMP-activated protein kinase activation in endothelial cells.
26457306 2015 Associations of C1q/TNF-Related Protein-9 Levels in Serum and Epicardial Adipose Tissue with Coronary Atherosclerosis in Humans.
26419929 2015 C1q/TNF-Related Protein 9 (CTRP9) attenuates hepatic steatosis via the autophagy-mediated inhibition of endoplasmic reticulum stress.
25105737 2014 Association of serum C1q/TNF-related protein-9 concentration with arterial stiffness in subjects with type 2 diabetes.
24357853 2014 Association of serum C1q/TNF-Related Protein-9 (CTRP9) concentration with visceral adiposity and metabolic syndrome in humans.
19666007 2009 CTRP8 and CTRP9B are novel proteins that hetero-oligomerize with C1q/TNF family members.
18787108 2009 Identification and characterization of CTRP9, a novel secreted glycoprotein, from adipose tissue that reduces serum glucose in mice and forms heterotrimers with adiponectin.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...