Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Creutzfeldt-Jakob disease 19

AA Sequence

MPDRACAVGSVARALSRSRRYVCARDADASRRRRRPFNYGLSIEEKNENDENSLSSSSDSSEDKDEKISE      1 - 70
ECDIEEKTEVKEEPELQTKREMEERTVTLEIPEVLKRQLEDDCYYINRRKRLVQLPCHTNIITILESYVK     71 - 140
HFAISAAFSANERPRHHHAMPHASMNVPYIPAEKNIDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKV    141 - 210
TASKVFLAIKESATNTNRSQEKLSPSLRLLNPSRPQSTESQSTSGEPATPKRRKAEPQAVQSLRRSSPHT    211 - 280
ANCDRLSKSSTSPQPKRWQQDMSTSVPKLFLHLEKKTPVHSRSSSPTLTPSQEGSPVFAGFEGRRTNEIN    281 - 350
EVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFTEKNLKALLKHFDLFVRFLAEYHD    351 - 420
DFFPESAYVAASEVHYSTRNPQAVNKC                                               421 - 447
//

Text Mined References (2)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.