Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Creutzfeldt-Jakob Syndrome 10 0.0 0.0
Disease Target Count
Creutzfeldt-Jakob disease 21

AA Sequence

MPDRACAVGSVARALSRSRRYVCARDADASRRRRRPFNYGLSIEEKNENDENSLSSSSDSSEDKDEKISE      1 - 70
ECDIEEKTEVKEEPELQTKREMEERTVTLEIPEVLKRQLEDDCYYINRRKRLVQLPCHTNIITILESYVK     71 - 140
HFAISAAFSANERPRHHHAMPHASMNVPYIPAEKNIDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKV    141 - 210
TASKVFLAIKESATNTNRSQEKLSPSLRLLNPSRPQSTESQSTSGEPATPKRRKAEPQAVQSLRRSSPHT    211 - 280
ANCDRLSKSSTSPQPKRWQQDMSTSVPKLFLHLEKKTPVHSRSSSPTLTPSQEGSPVFAGFEGRRTNEIN    281 - 350
EVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFTEKNLKALLKHFDLFVRFLAEYHD    351 - 420
DFFPESAYVAASEVHYSTRNPQAVNKC                                               421 - 447
//

Text Mined References (3)

PMID Year Title