Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 2.5e-05

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MQSHLAPLACAAAAGRAGGSCQAAQPEDRRVLRYPGTAVMVTCPNRPLVPRPLLTPGGSRASLALCAFVA      1 - 70
VPQRIPQPLLPAYILLMLPSLVVDMALPSSRLLRSIKPIQPASQVVRKERNPNPNCPQSDPLMKASSTSF     71 - 140
LSHTYLINKTRSTTRKVEEHSWFTCTGAKYFAIPLAERNTKRLTKRSTHAQLLRGKQDGSEWVVPRSSAS    141 - 210
SNVLYH                                                                    211 - 216
//

Text Mined References (2)

PMID Year Title