Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Synonym

Accession P0C854
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MQSHLAPLACAAAAGRAGGSCQAAQPEDRRVLRYPGTAVMVTCPNRPLVPRPLLTPGGSRASLALCAFVA      1 - 70
VPQRIPQPLLPAYILLMLPSLVVDMALPSSRLLRSIKPIQPASQVVRKERNPNPNCPQSDPLMKASSTSF     71 - 140
LSHTYLINKTRSTTRKVEEHSWFTCTGAKYFAIPLAERNTKRLTKRSTHAQLLRGKQDGSEWVVPRSSAS    141 - 210
SNVLYH                                                                    211 - 216
//

Text Mined References (2)

PMID Year Title
11381032 2001 Analysis of the cat eye syndrome critical region in humans and the region of conserved synteny in mice: a search for candidate genes at or near the human chromosome 22 pericentromere.
10591208 1999 The DNA sequence of human chromosome 22.