Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C841
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLASGAESQDRYRNTPSSRIFTPGFRPTPATTPEPGIYMFNMEPSQP                             1 - 47
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.