Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession P0C838
Symbols C8orf68

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
26393913 Results show that RP11-397D12.4, AC007403.1, and ERICH1-AS1 LncRNA expression are up-regulated in non-small-cell lung cancer (NSCLC) and may be potential biomarkers for predicting the tumorigenesis of NSCLC in the future.

AA Sequence

MGTAQVLPGILQKHCCILPDRNTGRLQTIVLLDWCTKYGFGVCVIQSIAPTKPQKLPRADVPLSVRLQDT      1 - 70
VPLLHGASRCLSLT                                                             71 - 84
//

Text Mined References (4)

PMID Year Title
26393913 2015 Three circulating long non-coding RNAs act as biomarkers for predicting NSCLC.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.