Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C7X4
Symbols FTHL19

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAFYFDQDDAALEHFDRYFLRQSQEKREHAQELMSLQNLRGGRICLHDIRKPEGQGWESGLKAMECTFHL      1 - 70
EKNINQSLLELHQLARENGDPQLCDFLENDFLNQQAKTIKELGGYLSNLHKMGAPEAGLAEYLFNKLTLG     71 - 140
RSQKHTRAQTGPTATGCLPLLAPPGGTSMFPFQNILFIFLLSVLPLLAIKLSVLKAIKVSS             141 - 201
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.