Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C7X3 B5MCU7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MACAVFQIPPWHLDRKYGSCSTILLDNSTASQPDLRHTLERYANRSLAIFEEPVHPLPQEKLPGKSFKHD      1 - 70
PKRNCIFRHFCTLFQVIKLTAPCAIVALVYIKRLLTSANIDLCPTNWKKIVLGTMLLASKVWRNHGLWSV     71 - 140
DDSQNSKDTAVENMSKMEKCFLELLEFNIHVSASVYAKYYFDLCALANDHDLYFLFSFLHKDKAQKLEGH    141 - 210
TSQHSLSLGPCRVGMENYATYSPLSSQPVLGALSLAEVLPQEIKQEIHQVLMDHGVPCHYTCFLLHPEDS    211 - 280
TLERFLVLHSIQGLQEDSVLCKVEIHGLSPQPQTYQSHFRSPSLAELLNRISGTCRNHFAGMQK          281 - 344
//

Text Mined References (1)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.