Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis -1.028 0.000
colon cancer -1.100 0.001
ovarian cancer -1.100 0.000

Gene RIF (1)

PMID Text
18976975 Knockdown of zinc finger protein 688 (ZNF688) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGFPGP      1 - 70
KPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNP     71 - 140
DPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERP    141 - 210
FPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG        211 - 276
//

Text Mined References (6)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.