Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 5.93606610952011E-11
ovarian cancer 8492 7.45049120341615E-6
colon cancer 1475 8.0338146573426E-4

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis -1.028 0.000
colon cancer -1.100 0.001
ovarian cancer -1.100 0.000

Synonym

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (1)

PMID Text
18976975 Knockdown of zinc finger protein 688 (ZNF688) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGFPGP      1 - 70
KPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNP     71 - 140
DPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERP    141 - 210
FPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG        211 - 276
//

Text Mined References (6)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.