Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
juvenile dermatomyositis 1187 5.9e-11
ovarian cancer 8519 7.5e-06
colon cancer 1478 8.0e-04

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.100 8.0e-04
juvenile dermatomyositis -1.028 5.9e-11
ovarian cancer -1.100 7.5e-06

Gene RIF (1)

AA Sequence

MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGFPGP      1 - 70
KPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNP     71 - 140
DPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERP    141 - 210
FPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG        211 - 276
//

Text Mined References (6)

PMID Year Title