Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Schizophrenia 501 1.0

AA Sequence

MLRYPYFCRMYKECLSCWLESGIPNLGVWPKRIHTTAEKYREYEAREQTDQTQVQELHRSQDRDFETMAK      1 - 70
LHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIR     71 - 140
AMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGRNISSLCYLYT    141 - 210
ERLTTAIYLYCHQDFPGSSHICEQ                                                  211 - 234
//

Text Mined References (2)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.