Property Summary

NCBI Gene PubMed Count 0
PubMed Score 10.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Hepatoid adenocarcinoma 2 3.999 2.0

Synonym

Accession P0C7V7
Symbols SPCS4B
SEC11L2

Gene

 GO Process (1)

AA Sequence

MNKWRLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVLLSGSMEPAFHRGYLLFLTNRVEDPIRVGEIA      1 - 70
VLRIEGRKIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQDQHWLEKKDVVGRARGFVPYIGIGT     71 - 140
SLMNDYPKHKYEVLFLLGLFVLVHRE                                                141 - 166
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.