Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C7V6
Symbols FAM48B1
FAM48B2

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MDRDLEQALDRTENITEIAQQRRPRRRYSPRAGKTLQEKLYDIYVEECGKEPEDPQELRSNVNLLEKLVR      1 - 70
RESLPCLLVNLYPGNQGYSVMLQREDGSFAETIRLPYEERALLDYLDAEELPPALGDVLDKASVNIFHSG     71 - 140
CVIVEVRDYRQSSNMQPPGYQSRHILLRPTMQTLAPEVKTMTRDGEKWSQEDKFPLESQLILATAEPLCL    141 - 210
DPSVAVACTANRLLYNKQKMNTDPMEQCLQRYSWPSVKPQQEQSDCPPPPELRVSTSGQKEERKVGQPCE    211 - 280
LNITKAGSCVDTWKGRPCDLAVPSEVDVEKLAKGYQSVTAADPQLPVWPAQEVEDPFRHAWEAGCQAWDT    281 - 350
KPNIMQSFNDPLLCGKIRPRKKARQKSQKSPWQPFPDDHSACLRPGSETDAGRAVSQAQESVQSKVKGPG    351 - 420
KMSHSSSGPASVSQLSSWKTPEQPDPVWVQSSVSGKGEKHPPPRTQLPSSSGKISSGNSFPPQQAGSPLK    421 - 490
RPFPAAAPAVAAAAPAPAPAPAAAPALAAAAVAAAAGGAAPSHSQKPSVPLIKASRRRPAAGRPTRFVKI    491 - 560
APAIQVRTGSTGLKATNVEGPVRGAQVLGCSFKPVQAPGSGAPAPAGISGSGLQSSGGPLPDARPGAVQA    561 - 630
SSPAPLQFFLNTPEGLRPLTLQVPQGWAVLTGPQQQSHQLVSLQQLQQPTAAHPPQPGPQGSTLGLSTQG    631 - 700
QAFPAQQLLNVNLTGAGSGLQPQPQAAVLSLLGSAQVPQQGVQLPFVLGQQPQPLLLLQPQPQPQQIQLQ    701 - 770
TQPLRVLQQPVFLATGAVQIVQPHPGVQAGSQLVGQRKGGKPTPPAP                           771 - 817
//

Text Mined References (2)

PMID Year Title