Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0C7V6
Symbols FAM48B1
FAM48B2

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MDRDLEQALDRTENITEIAQQRRPRRRYSPRAGKTLQEKLYDIYVEECGKEPEDPQELRSNVNLLEKLVR      1 - 70
RESLPCLLVNLYPGNQGYSVMLQREDGSFAETIRLPYEERALLDYLDAEELPPALGDVLDKASVNIFHSG     71 - 140
CVIVEVRDYRQSSNMQPPGYQSRHILLRPTMQTLAPEVKTMTRDGEKWSQEDKFPLESQLILATAEPLCL    141 - 210
DPSVAVACTANRLLYNKQKMNTDPMEQCLQRYSWPSVKPQQEQSDCPPPPELRVSTSGQKEERKVGQPCE    211 - 280
LNITKAGSCVDTWKGRPCDLAVPSEVDVEKLAKGYQSVTAADPQLPVWPAQEVEDPFRHAWEAGCQAWDT    281 - 350
KPNIMQSFNDPLLCGKIRPRKKARQKSQKSPWQPFPDDHSACLRPGSETDAGRAVSQAQESVQSKVKGPG    351 - 420
KMSHSSSGPASVSQLSSWKTPEQPDPVWVQSSVSGKGEKHPPPRTQLPSSSGKISSGNSFPPQQAGSPLK    421 - 490
RPFPAAAPAVAAAAPAPAPAPAAAPALAAAAVAAAAGGAAPSHSQKPSVPLIKASRRRPAAGRPTRFVKI    491 - 560
APAIQVRTGSTGLKATNVEGPVRGAQVLGCSFKPVQAPGSGAPAPAGISGSGLQSSGGPLPDARPGAVQA    561 - 630
SSPAPLQFFLNTPEGLRPLTLQVPQGWAVLTGPQQQSHQLVSLQQLQQPTAAHPPQPGPQGSTLGLSTQG    631 - 700
QAFPAQQLLNVNLTGAGSGLQPQPQAAVLSLLGSAQVPQQGVQLPFVLGQQPQPLLLLQPQPQPQQIQLQ    701 - 770
TQPLRVLQQPVFLATGAVQIVQPHPGVQAGSQLVGQRKGGKPTPPAP                           771 - 817
//

Text Mined References (2)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
15772651 2005 The DNA sequence of the human X chromosome.