Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.0e-48
Disease Target Count Z-score Confidence
Hepatoblastoma 19 3.01 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 1.0e-48

AA Sequence

MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLPLHYFRVVTWAVFVGLSLATFRIFIPLLPHSWKY      1 - 70
IAYVVTGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVNKKTKH     71 - 140
CISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQYLVNPRVLRTDPRYED    141 - 210
VKNMNTWLLFLPLFPVQVQTLIVVIIRMLVLLLDLLGLVQLGQLLIFHIYLKAKKMTTFEYLINTRKEES    211 - 280
SKHQAVRKDPYVQMDKGFLQQGAGALGSSAQGVKAKSSLLIYKCPCHFCTSVNQDGDSKAQEADDAPSTS    281 - 350
TLGLQQETTEPMKTDSAESED                                                     351 - 371
//

Text Mined References (1)

PMID Year Title