Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hepatoblastoma 17 3.453 1.7
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 0.000

AA Sequence

MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLPLHYFRVVTWAVFVGLSLATFRIFIPLLPHSWKY      1 - 70
IAYVVTGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVNKKTKH     71 - 140
CISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQYLVNPRVLRTDPRYED    141 - 210
VKNMNTWLLFLPLFPVQVQTLIVVIIRMLVLLLDLLGLVQLGQLLIFHIYLKAKKMTTFEYLINTRKEES    211 - 280
SKHQAVRKDPYVQMDKGFLQQGAGALGSSAQGVKAKSSLLIYKCPCHFCTSVNQDGDSKAQEADDAPSTS    281 - 350
TLGLQQETTEPMKTDSAESED                                                     351 - 371
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.