Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MEDRAGEQEQERHSLRLEKLQHWARHRQSGHLLVLAVSQLWLAVVVVPLAVSVACLNSDCHMATALPLGP      1 - 70
GASGLLTGTVTLELRRAPRLWKVRAMMIFNTFNLILGFIVVVVEVMKTALGPAPTASSQHAGLLVLELSA     71 - 140
EAFTLGGVLVSVHALFLLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERVGQREQT    141 - 210
RAALLPP                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title
12508121 2003 The DNA sequence and analysis of human chromosome 14.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.