Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.23
PubTator Score 78.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Ataxia, Spinocerebellar 15
Disease Target Count P-value
juvenile dermatomyositis 1189 1.34852368583843E-11
ovarian cancer 8492 6.71627801205746E-7
Amyotrophic Lateral Sclerosis 432 3.6718078125317E-6
acute quadriplegic myopathy 1157 2.16825533426953E-4
invasive ductal carcinoma 2950 6.45142808553496E-4
medulloblastoma, large-cell 6234 0.00453278569005386
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 6.047 3.0
Omphalocele 22 3.676 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell -1.700 0.005
juvenile dermatomyositis 1.483 0.000
Amyotrophic Lateral Sclerosis 1.152 0.000
acute quadriplegic myopathy 1.082 0.000
invasive ductal carcinoma -1.500 0.001
ovarian cancer -2.000 0.000

Synonym

Accession P0C7T5
Symbols BOAT
BOAT1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (2)

PMID Text
21475249 Both ATXN1 and BOAT1 bind to the promoter region of Hey1 and inhibit the transcriptional output of Notch through direct interactions with CBF1, a transcription factor that is crucial for the Notch pathway.
16121196 Boat is an in vivo binding partner of ataxin-1 whose altered expression in Purkinje cells may contribute to their degeneration in causes spinocerebellar ataxia type 1 animals

AA Sequence

MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEA      1 - 70
ITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHPGIHYPPLHYAQLPSTSLQFI     71 - 140
GSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQAPSPAHSFNKAPSATSPSGQ    141 - 210
LPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQSALEAAAANGGQRPRERNLV    211 - 280
RRESEALDSPNSKGEGQGLVPVVECVVDGQLFSGSQTPRVEVAAPAHRGTPDTDLEVQRVVGALASQDYR    281 - 350
VVAAQRKEEPSPLNLSHHTPDHQGEGRGSARNPAELAEKSQARGFYPQSHQEPVKHRPLPKAMVVANGNL    351 - 420
VPTGTDSGLLPVGSEILVASSLDVQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQT    421 - 490
QDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRT    491 - 560
TQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPSQLGPPRERPERTVLGSRELCDSEGKSQPAGE    561 - 630
GSRVVEPSQPESGAQACWPAPSFQRYSMQGEEARAALLRPSFIPQEVKLSIEGRSNAGK               631 - 689
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21475249 2011 Ataxin-1 and Brother of ataxin-1 are components of the Notch signalling pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17322884 2007 Duplication of Atxn1l suppresses SCA1 neuropathology by decreasing incorporation of polyglutamine-expanded ataxin-1 into native complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16121196 2005 Boat, an AXH domain protein, suppresses the cytotoxicity of mutant ataxin-1.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...