Property Summary

NCBI Gene PubMed Count 3
PubMed Score 15.27
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Plague 19 5.809 2.9

Expression

AA Sequence

MEIFIEVFSHFLLQLTELTLNMCLELPTGSLEKSLMISSQVLQIPVANSTKQR                       1 - 53
//

Text Mined References (3)

PMID Year Title