Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available

AA Sequence

ILHHLIPPALNPIVYGVRTKEIKQGIQNLLRRL                                         281 - 313

Text Mined References (1)

PMID Year Title