Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18950845 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGSHPYLNPPDSTHPSPPSAPPSLRWHQCCQPSDATNGLLVALLGGGLPAGFVGPLSHMAYQASNLPSL      1 - 70
ELLICRCLFHLPIALLLKLRGDPLLGPPDIRGRAYFYALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTV     71 - 140
CSAVLTLCLESQGLSGYDWCGLLGSILGLIIIVGPGLWTLQEGITGVYTALGYGQAFVGGLALSLGLLVY    141 - 210
RSLHFPSCLPTVAFLSGLVGLLGSVPGLFVLQPPVLPSDLPSWSCVGAVGILALVSFTCVSYAVTKAHPA    211 - 280
LVCAVLHSEVVVALILQYYMLHETVAPSDIVGAGVVLGSIAIITAWNLSCEREGKVEE                281 - 338
//

Text Mined References (3)

PMID Year Title
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
17101974 2006 Emergence of primate genes by retrotransposon-mediated sequence transduction.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.