Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MEGMEDAGEEAGEDAGEDAREGAAAPAARVHFRVARFIMEAGVKLGMQSIPIATACTIYPKFFCETILDA      1 - 70
FDPYLIAMSSIYLAGKVEEQPLWAHDIISVSNRYFNPSSEPLGLDSRLWELRDSIVQRELLMLRVLRFQV     71 - 140
SFQHPHKYLLYYLVSLKNWLNCHSWQRTPVAVTAWALLRDSYHGGLCLRFQAQHIAVVVLYLALQVYGVE    141 - 210
VPAEVEAEKLWWQAFSDDLTKPIIDTIVSDLIQIYTIDTEIP                                211 - 252
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15897902 2005 KIF14 is a candidate oncogene in the 1q minimal region of genomic gain in multiple cancers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.