Property Summary

NCBI Gene PubMed Count 187
Grant Count 62
R01 Count 38
Funding $14,571,133.75
PubMed Score 217.69
PubTator Score 175.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C7Q2 B2Y7I5
Symbols ARMD8

Gene

Gene RIF (213)

PMID Text
26427389 Studies indicate that the high-risk allele of the 10q26 locus encompasses three genes, PLEKHA1, ARMS2, and HTRA1 with high linkage disequilibrium.
26337002 The growth of choroidal neovascularization in AMD would be affected by 2 genes: MMP20, a newly confirmed gene expressed in the retina, and ARMS2/HTRA1, a well-known susceptibility gene for AMD.
26275133 GRS using ARMS2, CFH, TNFRSF10A, VEGFA, and CFI was significantly associated with second-eye involvement. Genetic risk has high predictive ability for second-eye involvement of AMD.
26132079 No significant interaction was found between DHA supplementation benefit and ARMS2 A69S SNP.
25792034 results suggest that calcium, ARMS2 genotype, C. pneumonia infection, and age are significant factors in the development of the early stages of AMD.
25786237 Determined the differential effects of genetic polymorphism in CFH and ARMS2 on risk of age-related macular degeneration (AMD)
25771815 In this study, we found that the interaction of ARMS2 and ARMS2/HTRA1 is significantly associated with nAMD, and the interaction of CFH and ARMS2 is pronounced in PCV development in Chinese population.
25715554 There is association of ARMS2 gene polymorphism with different subtypes of Age-related macular degeneration
25695752 Patients carrying 4 risk alleles in CFH and ARMS2 developed neovascular AMD 12.2 (95% CI, 6.2-18.3) years earlier than patients with zero risk alleles (P < .001).
25519903 HTRA1 gene is transcriptionally regulated by insertion/deletion nucleotides located at the 3' end of the ARMS2 gene in patients with age-related macular degeneration.
More...

AA Sequence

MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK      1 - 70
IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR                                      71 - 107
//

Text Mined References (192)

PMID Year Title
26427389 2016 Gene Structure of the 10q26 Locus: A Clue to Cracking the ARMS2/HTRA1 Riddle?
26337002 2015 MMP20 and ARMS2/HTRA1 Are Associated with Neovascular Lesion Size in Age-Related Macular Degeneration.
26275133 2015 The Contribution of Genetic Architecture to the 10-Year Incidence of Age-Related Macular Degeneration in the Fellow Eye.
26132079 2015 CFH Y402H and ARMS2 A69S Polymorphisms and Oral Supplementation with Docosahexaenoic Acid in Neovascular Age-Related Macular Degeneration Patients: The NAT2 Study.
25792034 2015 Calcium, ARMS2 genotype, and Chlamydia pneumoniae infection in early age-related macular degeneration: a multivariate analysis from the Nagahama study.
25786237 2015 Lens status influences the association between CFH polymorphisms and age-related macular degeneration: findings from two population-based studies in Singapore.
25771815 2015 Gene-gene interaction of CFH, ARMS2, and ARMS2/HTRA1 on the risk of neovascular age-related macular degeneration and polypoidal choroidal vasculopathy in Chinese population.
25715554 [Age-related macular degeneration].
25695752 2015 Association of Smoking and CFH and ARMS2 Risk Variants With Younger Age at Onset of Neovascular Age-Related Macular Degeneration.
25519903 2015 HTRA1 (high temperature requirement A serine peptidase 1) gene is transcriptionally regulated by insertion/deletion nucleotides located at the 3' end of the ARMS2 (age-related maculopathy susceptibility 2) gene in patients with age-related macular degeneration.
More...