Property Summary

NCBI Gene PubMed Count 203
PubMed Score 234.41
PubTator Score 175.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (228)

AA Sequence

MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK      1 - 70
IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR                                      71 - 107
//

Text Mined References (208)

PMID Year Title