Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 0.001

Synonym

Accession P0C7P2 Q5TI83 Q5TI84
Symbols RFPL3AS
RFPL3-AS
RFPL3ANT
RFPL3-AS1
NCRNA00005

Gene

 Compartment GO Term (0)

AA Sequence

MQTDTSNLSARSCRFCVMSPLRTLLRSSEMRRKLLAVSASKVISTVKRKTSCSASGQKPTPCLSSTSKAQ      1 - 70
ISPDFSFFNSVSSSKIKTFHEETSLFQIFIGMLCGNT                                      71 - 107
//

Text Mined References (4)

PMID Year Title
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
10508838 1999 Duplications on human chromosome 22 reveal a novel Ret Finger Protein-like gene family with sense and endogenous antisense transcripts.