Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 1.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 1.3e-03

AA Sequence

MQTDTSNLSARSCRFCVMSPLRTLLRSSEMRRKLLAVSASKVISTVKRKTSCSASGQKPTPCLSSTSKAQ      1 - 70
ISPDFSFFNSVSSSKIKTFHEETSLFQIFIGMLCGNT                                      71 - 107
//

Text Mined References (4)

PMID Year Title