Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MTQINCTQVTEFILVGLTDRQELKMPLFVLFLSIYLFTVVGNLGLILLIRTDEKLNTPMYFFLSNLAFVD      1 - 70
FCYSSVITPKMLGNFLYKQNSISFNACAAQLGCFLAFMTAECLLLASMAYDRYVAICNPLMYMVVMSPGI     71 - 140
CIQLVAAPHSYSILVALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWIFACAGIMFISS    141 - 210
LLIVFVSYMFIISAILRMHSAEGRQKAFSTCGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTV    211 - 280
IIPMLNPLIYSLQNKEVKEALKKIIINKN                                             281 - 309
//

Text Mined References (4)

PMID Year Title
21328370 2011 Benefits of random-priming: exhaustive survey of a cDNA library from lung tissue of a SARS patient.
17803354 2007 The diploid genome sequence of an individual human.
15496913 2004 Finishing the euchromatic sequence of the human genome.
11237011 2001 Initial sequencing and analysis of the human genome.