Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.15

Knowledge Summary

Patent

No data available

AA Sequence

MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMYFFLSNLAFVD      1 - 70
FCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMVSESLLLASMAYDRYVAICNPLLYMVVMTPGI     71 - 140
CIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCDDMPLLRLTCSDTRFKQLWILACAGITFICS    141 - 210
VLIVFVSYMFIIFAILRMSSAEGRRKAFSTCSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTV    211 - 280
IIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLKLRK                                   281 - 319
//

Text Mined References (2)

PMID Year Title
15496913 2004 Finishing the euchromatic sequence of the human genome.
11237011 2001 Initial sequencing and analysis of the human genome.