Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.41569042580093E-19
oligodendroglioma 2849 9.55179430402652E-19
psoriasis 6685 3.78760131751833E-17
pilocytic astrocytoma 3086 2.43415291186887E-11
sonic hedgehog group medulloblastoma 1482 4.64014585555527E-8
adult high grade glioma 2148 9.32612929300138E-8
glioblastoma 5572 2.24926796486584E-7
medulloblastoma, large-cell 6234 3.11716467241509E-7
atypical teratoid / rhabdoid tumor 4369 4.98961169769086E-6
primitive neuroectodermal tumor 3031 0.0025046763807053
astrocytic glioma 2241 0.00466539603412165

Expression

  Differential Expression (11)

AA Sequence

MEPAREPPSRARPPPPLAARPAPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEDTTTRLL      1 - 70
LGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQS     71 - 140
QKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSK    141 - 210
MAYT                                                                      211 - 214
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
11181995 2001 The sequence of the human genome.