Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.300 9.3e-08
astrocytic glioma -1.100 4.7e-03
Astrocytoma, Pilocytic -2.100 7.4e-11
atypical teratoid / rhabdoid tumor -1.700 5.0e-06
ependymoma -1.300 2.8e-03
glioblastoma -1.900 1.5e-12
group 3 medulloblastoma -1.300 3.7e-04
medulloblastoma, large-cell -2.000 3.1e-07
oligodendroglioma -1.100 9.6e-19
primitive neuroectodermal tumor -1.400 2.5e-03
psoriasis 1.500 3.8e-17

AA Sequence

MEPAREPPSRARPPPPLAARPAPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEDTTTRLL      1 - 70
LGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQS     71 - 140
QKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSK    141 - 210
MAYT                                                                      211 - 214
//

Text Mined References (3)

PMID Year Title