Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

AA Sequence

MEPAREPPSRARPPPPLAARPAPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKAALEDTTTRLL      1 - 70
LGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQS     71 - 140
QKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEPTRLVSTECLMTRPWVCSK    141 - 210
MAYT                                                                      211 - 214
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
11181995 2001 The sequence of the human genome.