Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.21
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acquired immunodeficiency syndrome 164 3.56 1.8

Expression

Synonym

Accession P0C7M7 A8MTI6
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23982661 SNPs associated with rapid AIDS progression
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKIFFRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADVLDQWSQKEKTGE      1 - 70
RPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPCGLQRGDRLAVILPRIPEWWLVNVACIRTGII     71 - 140
FMPGTIQLTAKDILYRLRASKAKCIVASEEVAPAVESIVLECPDLKTKLLVSPQSWNGWLSFQELFQFAS    141 - 210
EEHSCVETGSQEPMTIYFTSGTTGFPKMAQHSQSSLGIGFTLCGRYWLDLKSSDIIWNMSDTGWVKAAIG    211 - 280
SVFSSWLCGACVFVHRMAQFDTDTFLDTLTTYPITTLCSPPTVYRMLVQKDLKRYKFKSLRHCLTGGEPL    281 - 350
NPEVLEQWRVQTGLELYEGYGQTEVGMICANQKGQEIKPGSMGKGMLPYDVQIIDENGNVLPPGKEGEIA    351 - 420
LRLKPTRPFCFFSKYVDNPQKTAATIRGDFYVTGDRGVMDSDGYFWFVGRADDVIISSGYRIGPFEVESA    421 - 490
LIEHPAVVESAVVSSPDQIRGEVVKAFVVLAAPFKSYNPEKLTLELQDHVKKSTAPYKYPRKVEFVQELP    491 - 560
KTITGKIKRNVLRDQEWRGR                                                      561 - 580
//

Text Mined References (4)

PMID Year Title
23982661 2014 ACSM4 polymorphisms are associated with rapid AIDS progression in HIV-infected patients.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17762044 2007 Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.
16541075 2006 The finished DNA sequence of human chromosome 12.