Property Summary

NCBI Gene PubMed Count 6
Grant Count 12
R01 Count 4
Funding $1,431,835.98
PubMed Score 66.89
PubTator Score 27.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Argentine hemorrhagic fever 8 3.935 2.0

Expression

Gene RIF (3)

PMID Text
24743970 SFTA3 is an immunoregulatory protein of the lung with relevant protective functions during inflammation at the mucosal sites
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRAGFSDFQLIRDQVLFLQDQAQRLTEWLQLSGFENPVSESTTLCLREREKRIPTCVAVCVPSPGTVHTA      1 - 70
LLHPTTLSQSRSSSEAKMLIIHTA                                                   71 - 94
//

Text Mined References (8)

PMID Year Title
24939938 2014 Long noncoding RNAs are spatially correlated with transcription factors and regulate lung development.
24743970 2014 SFTA3, a novel protein of the lung: three-dimensional structure, characterisation and immune activation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.