Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.336 0.000
adrenocortical carcinoma -1.011 0.000
subependymal giant cell astrocytoma 1.324 0.019

AA Sequence

MLLPASDPLLAGLPRDPDYSVSCLYSPPSPSSMCLPANMKCDKYWGSSSDKALERTAHWSRTPEPETLGC      1 - 70
PASGDTVRTADCRPGWGSGPSPHEAAPSPSPDLQKQCCNDQDILKRHHNVAKKPLETSSSKVKAKTIVMI     71 - 140
PDSQKLLRCELESLKSQLQAQTKAFEFLNHSVTMLEKESCLQQIKIQQLEEVLSPTGRQGEKEEHKWGME    141 - 210
QGRQELYGALTQGLQGLEKTLRDSEEMQRARTTRCLQLLAQEIRDSKKFLWEELELVREEVTFIYQKLQA    211 - 280
QEDEISENLVNIQKMQKTQVKCRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHV    281 - 350
LQNSIDSLTLCSGACPKASSLRGHKGHQCLSPPLPSWDSDSDCDQDLSQPPFSKSGRSFPPA            351 - 412
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.