Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.38
PubTator Score 0.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 3.3e-08
psoriasis 6694 1.1e-03
ovarian cancer 8520 1.5e-03
Atopic dermatitis 952 1.8e-02

AA Sequence

MTGSCCGSTLSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC                 71 - 128
//

Text Mined References (6)

PMID Year Title