Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -1.773 0.000
ependymoma -2.000 0.000
glioblastoma -2.900 0.000
medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.700 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.100 0.000
subependymal giant cell astrocytoma -1.988 0.036
progressive supranuclear palsy 1.600 0.019
ovarian cancer -2.700 0.000
psoriasis -1.600 0.000

AA Sequence

MGCAYSCCLEVCCGEDEIVYPRMPGESTVCHREREKPITYHWYHWHPGHIYPRVASMEDYDEDLVQEASS      1 - 70
EDVLGVHMVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSE     71 - 140
TLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEEHGPGQTVSEEATEVH    141 - 210
MMEGDPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQV    211 - 280
DPATPAKSDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEK    281 - 350
TKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF                                     351 - 387
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9776767 1998 A method for global protein expression and antibody screening on high-density filters of an arrayed cDNA library.