Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.36831711021419E-25
ovarian cancer 8492 8.72059737321294E-18
ependymoma 2514 3.10739564332639E-16
atypical teratoid / rhabdoid tumor 4369 1.31805643048645E-13
glioblastoma 5572 1.88029025185298E-9
medulloblastoma 1524 3.4820691171733E-9
pilocytic astrocytoma 3086 3.93642349605738E-7
osteosarcoma 7933 5.18493404840548E-7
primitive neuroectodermal tumor 3031 1.97037235600825E-6
pediatric high grade glioma 2712 3.03467922933873E-6
medulloblastoma, large-cell 6234 1.54977901090551E-5
progressive supranuclear palsy 674 0.0185177183245948
subependymal giant cell astrocytoma 2287 0.0355199969069619

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -1.773 0.000
ependymoma -2.000 0.000
glioblastoma -2.900 0.000
medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -2.700 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.100 0.000
subependymal giant cell astrocytoma -1.988 0.036
progressive supranuclear palsy 1.600 0.019
ovarian cancer -2.700 0.000
psoriasis -1.600 0.000

AA Sequence

MGCAYSCCLEVCCGEDEIVYPRMPGESTVCHREREKPITYHWYHWHPGHIYPRVASMEDYDEDLVQEASS      1 - 70
EDVLGVHMVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSE     71 - 140
TLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEEHGPGQTVSEEATEVH    141 - 210
MMEGDPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQV    211 - 280
DPATPAKSDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEK    281 - 350
TKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF                                     351 - 387
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9776767 1998 A method for global protein expression and antibody screening on high-density filters of an arrayed cDNA library.