Property Summary

NCBI Gene PubMed Count 6
PubMed Score 33.70
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma multiforme 1.100 2.5e-22
ovarian cancer 2.200 9.9e-06
pancreatic cancer 1.100 8.4e-05
pancreatic carcinoma 1.100 8.4e-05
pancreatic ductal adenocarcinoma liver m... -1.324 1.6e-02

Gene RIF (3)

AA Sequence

MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE                                       1 - 37
//

Text Mined References (8)

PMID Year Title