Property Summary

NCBI Gene PubMed Count 6
Grant Count 13
R01 Count 7
Funding $2,925,711.84
PubMed Score 30.73
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic cancer 1.100 0.000
glioblastoma multiforme 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.324 0.016
pancreatic carcinoma 1.100 0.000
ovarian cancer 2.200 0.000

Gene RIF (3)

PMID Text
21609714 This study determined the solution structure of human Ost4 in solvent system using NMR spectroscopy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE                                       1 - 37
//

Text Mined References (8)

PMID Year Title
23606741 2013 OST4 is a subunit of the mammalian oligosaccharyltransferase required for efficient N-glycosylation.
21609714 2011 Solution structure of a human minimembrane protein Ost4, a subunit of the oligosaccharyltransferase complex.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16317064 2006 An evolving view of the eukaryotic oligosaccharyltransferase.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.