Property Summary

NCBI Gene PubMed Count 5
PubMed Score 28.01
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MSCCLSSRVHITRPVLEQFLSFAKYLDGLSHGVPLLKQLCDHILFINPAIWIHTPAKVQLSLYTYLSAEF      1 - 70
IGTATIYTTICRIGTVIKDNAHLKILLLGY                                             71 - 100
//

Text Mined References (5)

PMID Year Title