Property Summary

NCBI Gene PubMed Count 5
Grant Count 9
R01 Count 4
Funding $486,600.5
PubMed Score 25.61
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
12160729 The BCL8 gene family evolved by transchromosomal and intrachromosomal duplications within the human genome.

AA Sequence

MSCCLSSRVHITRPVLEQFLSFAKYLDGLSHGVPLLKQLCDHILFINPAIWIHTPAKVQLSLYTYLSAEF      1 - 70
IGTATIYTTICRIGTVIKDNAHLKILLLGY                                             71 - 100
//

Text Mined References (5)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12160729 2002 BCL8 is a novel, evolutionarily conserved human gene family encoding proteins with presumptive protein kinase A anchoring function.
9159141 1997 BCL8, a novel gene involved in translocations affecting band 15q11-13 in diffuse large-cell lymphoma.