Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.005
ependymoma -3.800 0.000
oligodendroglioma -1.900 0.002
glioblastoma -3.900 0.000
medulloblastoma -4.100 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -4.300 0.000
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -3.900 0.000
subependymal giant cell astrocytoma -1.291 0.026
pituitary cancer 1.100 0.045

AA Sequence

MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKY      1 - 70
LLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGADPSLEDRTGASALVYAINADDKDALKHLLD     71 - 140
ACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRHSPPLCASPSDIELKALGLDSPLTEKEDDFF    141 - 210
SLQAGHPSSCNTSKAVNEPGSPTRKVSNLKRARLPQLKRLQSEPWGLIAPSVLAASTRQDETHGASTDNE    211 - 280
VIKSISDISFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWKAAYEKGQAPHPRLARRGTLP    281 - 350
VDQEKCGMGPSGPSALKEPASLKWLENDLYDLDIQPGPDPPNSISLESGKGPLDRKKLNSSHLSLFHGSR    351 - 420
ESLDTVPSTSPSSARRRPPHLLERRGSGTLLLDRISHTRPGFLPPLNVNLNPPIPDIRSSSKPSCSLASG    421 - 490
LKSMVPVAPSSPKRVDLRSKKKLLRRHSMQIEQMKQLSDFEEIMT                             491 - 535
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.