Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 2.06282489017885E-27
atypical teratoid / rhabdoid tumor 4369 1.33825842526647E-15
medulloblastoma 1524 7.68324850333944E-14
pilocytic astrocytoma 3086 6.7808950449042E-12
pediatric high grade glioma 2712 7.13580145277085E-9
glioblastoma 5572 7.53320532806069E-8
primitive neuroectodermal tumor 3031 7.97549534647917E-8
medulloblastoma, large-cell 6234 2.36896093699884E-6
oligodendroglioma 2849 0.00186604793584154
astrocytic glioma 2241 0.00491310591845987
subependymal giant cell astrocytoma 2287 0.0258027525047088
pituitary cancer 1972 0.045268885821961

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.005
ependymoma -3.800 0.000
oligodendroglioma -1.900 0.002
glioblastoma -3.900 0.000
medulloblastoma -4.100 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -4.300 0.000
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -3.900 0.000
subependymal giant cell astrocytoma -1.291 0.026
pituitary cancer 1.100 0.045

AA Sequence

MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKY      1 - 70
LLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGADPSLEDRTGASALVYAINADDKDALKHLLD     71 - 140
ACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRHSPPLCASPSDIELKALGLDSPLTEKEDDFF    141 - 210
SLQAGHPSSCNTSKAVNEPGSPTRKVSNLKRARLPQLKRLQSEPWGLIAPSVLAASTRQDETHGASTDNE    211 - 280
VIKSISDISFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWKAAYEKGQAPHPRLARRGTLP    281 - 350
VDQEKCGMGPSGPSALKEPASLKWLENDLYDLDIQPGPDPPNSISLESGKGPLDRKKLNSSHLSLFHGSR    351 - 420
ESLDTVPSTSPSSARRRPPHLLERRGSGTLLLDRISHTRPGFLPPLNVNLNPPIPDIRSSSKPSCSLASG    421 - 490
LKSMVPVAPSSPKRVDLRSKKKLLRRHSMQIEQMKQLSDFEEIMT                             491 - 535
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.