Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.67
PubTator Score 995.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession P0C6A0
Symbols GLP1
GLP-1
GATAD3

Gene

Gene RIF (2)

PMID Text
26752550 There is minor contribution of endogenous GLP-1 and GLP-2 to postprandial lipemia in obese men.
16982049 Characterization and functional analysis of the mouse GLP-1 ortholog, and comparison to the human protein.

AA Sequence

MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQESVTALCFLQETVERLGQS      1 - 70
PAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERV     71 - 140
DPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADAVGGPAAHPGGTEAHSAGSEALEPRRCASCR    141 - 210
TQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG             211 - 271
//

Text Mined References (6)

PMID Year Title
26752550 2016 Minor Contribution of Endogenous GLP-1 and GLP-2 to Postprandial Lipemia in Obese Men.
16982049 2007 GLP-1: a novel zinc finger protein required in somatic cells of the gonad for germ cell development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.