Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.67
PubTator Score 995.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

Expression

Gene RIF (2)

AA Sequence

MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQESVTALCFLQETVERLGQS      1 - 70
PAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERV     71 - 140
DPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADAVGGPAAHPGGTEAHSAGSEALEPRRCASCR    141 - 210
TQRTPLWRDAEDGTPLCNACGIRYKKYGTRCSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG             211 - 271
//

Text Mined References (6)

PMID Year Title